PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009774295.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 469aa    MW: 51476.7 Da    PI: 4.9677
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009774295.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof124.82.8e-39116175261
          zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                     ++k+l+cprC+s++tkfCy+nny++sqPr+fCk+C+ryWt+GG++rnvPvG+grrknk+s
  XP_009774295.1 116 PDKILPCPRCNSMETKFCYFNNYNVSQPRHFCKNCQRYWTAGGTMRNVPVGAGRRKNKNS 175
                     68999****************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-29113173IPR003851Zinc finger, Dof-type
PfamPF027015.2E-32118174IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.798120174IPR003851Zinc finger, Dof-type
PROSITE patternPS013610122158IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 469 aa     Download sequence    Send to blast
MSELKDPAIK LFGKTIQLPD IQESLQDDSS PEETNEEEEE EDVQTHKDDF GGHLDDDKDE  60
MGTLTGKELQ DQNSDQSRSD TIEGPPVDND GSTRPSKSEE EQGEASNSQE KILKRPDKIL  120
PCPRCNSMET KFCYFNNYNV SQPRHFCKNC QRYWTAGGTM RNVPVGAGRR KNKNSISHYR  180
QISVPETLPN AQTDYPNGIQ QPILAFGSHK PLCESMASVL NIADKTMHNC PPNGFHKPEE  240
SRVQVSYGAG DNGDDHSRRS SVSAANSEDE VNKIGPDLLR KNCPSFPPYL ACYPGAAWPY  300
PCSSVHWTSA VPPPGYCPPV FPIPFYPTAA YWGYNVAGSW NVPLASPPTA SLTQTPPTSG  360
PNSPLGKHSR DENILKPLNS KEEPSKESNH EKCLWVPKTL RIDDPGEAAK SSIWATLGIK  420
HDSVDSVGGS PFSAFQSKND GNNSVSENST VLQANPAALS RSLNFNEGL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00046PBMTransfer from AT5G39660Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755140.0HG975514.1 Solanum lycopersicum chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009774295.10.0PREDICTED: cyclic dof factor 3-like
RefseqXP_016473415.10.0PREDICTED: cyclic dof factor 3-like
TrEMBLA0A0V0IGG60.0A0A0V0IGG6_SOLCH; Putative cyclic dof factor 2-like
STRINGPGSC0003DMT4000646950.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA53224122
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G39660.23e-94cycling DOF factor 2